PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009630583.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family CO-like
Protein Properties Length: 403aa    MW: 44727.7 Da    PI: 5.6172
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009630583.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box19.52e-061354439
        zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Htv 39
                    ++C+++ +   + +C+ ++ +lC+ C   +H        H++
  XP_009630583.1 13 KVCDTCRSTACTVYCRADSAYLCAGCDARIHAAnlvasrHER 54
                    68******99*********************65677777765 PP

2zf-B_box28.92.4e-0955100342
        zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42 
                      ++C+ +e+ ++ + C+ +   lC++C   +H+       H +vp+
  XP_009630583.1  55 VWVCEACERAPAAFLCKADAASLCASCDADIHSAnplarrHHRVPI 100
                     689*****************************66899999877775 PP

3CCT69.87.2e-24334377144
             CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                     Rea++lRY+eK+k+RkFeK+irY+sRKa+Ae+RpR+KGrF+k++
  XP_009630583.1 334 REARVLRYREKKKNRKFEKTIRYASRKAYAETRPRIKGRFAKRT 377
                     9*****************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.0821057IPR000315B-box-type zinc finger
SMARTSM003365.4E-81057IPR000315B-box-type zinc finger
CDDcd000212.03E-71457No hitNo description
PROSITE profilePS5011911.12153100IPR000315B-box-type zinc finger
PfamPF006432.7E-754100IPR000315B-box-type zinc finger
CDDcd000211.21E-956100No hitNo description
SMARTSM003363.7E-958100IPR000315B-box-type zinc finger
PfamPF062039.2E-18334376IPR010402CCT domain
PROSITE profilePS5101716.638334376IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009658Biological Processchloroplast organization
GO:0009909Biological Processregulation of flower development
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048576Biological Processpositive regulation of short-day photoperiodism, flowering
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 403 aa     Download sequence    Send to blast
MLKKENSSNN WAKVCDTCRS TACTVYCRAD SAYLCAGCDA RIHAANLVAS RHERVWVCEA  60
CERAPAAFLC KADAASLCAS CDADIHSANP LARRHHRVPI MPIPGTLYGP PAVDTLSGGT  120
LMIGGPEGDA TEDDGFLSLT QDADDTTIDE EDKDEAASWL LLNLPVKNNN KNINNNNNNQ  180
NNYGMLFGGE VVDEYLDLAE YGGDSQFNDQ YSVNQQQQNY SVPQKNYGGD SVVPVQDRQG  240
KSMILYQQQQ QQQQQHNHHL SFQLGMEYDN SNTGYGYPAS MSHSVSISSI DVSVVPESAL  300
SETSNSHPRL PKGTIDLFSG PPIQMPTQLT PMDREARVLR YREKKKNRKF EKTIRYASRK  360
AYAETRPRIK GRFAKRTDVE AEVDQMFSTQ LIADSSYGIV PSF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ6869410.0JQ686941.1 Nicotiana tabacum cultivar SR1 constans (CO) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009630583.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 2
SwissprotQ965021e-133COL2_ARATH; Zinc finger protein CONSTANS-LIKE 2
TrEMBLV9LXL20.0V9LXL2_TOBAC; Constans
STRINGSolyc02g089540.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA52482337
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02380.12e-97CONSTANS-like 2